Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006271-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006271-M01, RRID:AB_463800
- Product name
- S100A1 monoclonal antibody (M01), clone 1D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant S100A1.
- Antigen sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELK
ELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEV
DFQEY- Isotype
- IgG
- Antibody clone number
- 1D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references FISH scoring on paraffin sections versus single-cell suspension for chromophobe renal carcinoma and renal oncocytoma.
Brunelli M, Segala D, Delahunt B, Parolini C, Bersani S, Cheng L, Eble JN, Chilosi M, Gobbo S, Martignoni G
Anticancer research 2011 Oct;31(10):3137-42
Anticancer research 2011 Oct;31(10):3137-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of S100A1 expression in transfected 293T cell line by S100A1 monoclonal antibody (M01), clone 1D5.Lane 1: S100A1 transfected lysate(10.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged S100A1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol