HPA006462

S100A1 antibody from Sigma-Aldrich
S100-alpha, S100A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006462
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006462, RRID:AB_1079857
Product name
Anti-S100A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006462
Antibody type
Polyclonal
Antigen
Protein S100-A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKE
LLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVD
FQEYVVLVAALTVACNNFFWENS
Storage
-20C
Provider Type Product Number
- No reagents -