HPA027345

SNRNP40 antibody from Atlas Antibodies
HPRP8BP, PRP8BP, PRPF8BP, SPF38, WDR57
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA027345
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027345, RRID:AB_2239703
Product name
Anti-SNRNP40
Provider product page
Atlas Antibodies - HPA027345
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDK
TVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQL
VCTGSDDGTVKLWDIRKKAAIQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -