AV33635

CLDN15 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
AV33635
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV33635, RRID:AB_1846861
Product name
Anti-CLDN15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV33635
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CLDN15 with an internal ID of P04693
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
CSACCCGSDEDPAASARRPYQAPVSVMPVATSDQE
GDSSFGKYGRNAYV
Storage
-20C
Provider Type Product Number
- No reagents -