SAB1401602

CLDN15 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB1401602
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401602, RRID:AB_10609172
Product name
Anti-CLDN15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401602
Antibody type
Polyclonal
Antigen
CLDN15 (NP_055158.1, 1 a.a. ~ 228 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVH
GNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLA
LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNI
GGLELSRKAKLAATAGALHILAGICGMVAISWYAF
NITRDFFDPLYPGTKYELGPALYLGWSASLISILG
GLCLCSACCCGSDEDPAASARRPYQAPVSVMPVAT
SDQEGDSSFGKYGRNAYV
Storage
-20C
Provider Type Product Number
- No reagents -