ARP59916_P050

MRGPRD antibody from Aviva Systems Biology
mrgD
Eligible for validation within the Antibodypedia Validation Initiative
No application information provided.

Antibody data

Product number
ARP59916_P050
Provider
Aviva Systems Biology
Product name
MRGPRD Antibody (ARP59916_P050)
Provider product page
Aviva Systems Biology - ARP59916_P050
Antibody type
Polyclonal
Antigen
The immunogen is a synthetic peptide directed towards the following sequence SLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRR
Description
Affinity Purified
Reactivity
Human, Rat, Guinea Pig
Host
Rabbit
Vial size
100 μl
Concentration
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Provider Type Product Number
- No reagents -