Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028811 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028811, RRID:AB_10603875
- Product name
- Anti-MRGPRF
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTI
EQIAMLP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and MRGPRF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403413).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line BJ shows localization to nuclear membrane & plasma membrane.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human prostate and skeletal muscle tissues using HPA028811 antibody. Corresponding MRGPRF RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows moderate positivity of the nuclear membrane in myocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows weak to moderate membranous positivity in stromal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate membranous positivity in smooth muscle cells.
- Sample type
- HUMAN