HPA016800

SAMD4B antibody from Sigma-Aldrich
FLJ10211, hSmaug2, MGC99832, SMGB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016800, RRID:AB_1856552
Product name
Anti-SAMD4B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016800
Antibody type
Polyclonal
Antigen
Sterile alpha motif domain-containing protein 4B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATTLEDRNALALWLSHLEERLASGFRSRPEPSYHS
RQGSDEWGGPAELGPGEAGPGWQDKPPRENGHVPF
HPSSSVPPAINSIGSNANTGLPCQIHPSPLK
Storage
-20C
Provider Type Product Number
- No reagents -