HPA016800

SAMD4B antibody from Atlas Antibodies
FLJ10211, hSmaug2, MGC99832, SMGB

Antibody data

Product number
HPA016800
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016800, RRID:AB_1856552
Product name
Anti-SAMD4B
Provider product page
Atlas Antibodies - HPA016800
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATTLEDRNALALWLSHLEERLASGFRSRPEPSYHS
RQGSDEWGGPAELGPGEAGPGWQDKPPRENGHVPF
HPSSSVPPAINSIGSNANTGLPCQIHPSPLK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.