H00093408-B01

MYL10 antibody from Abnova Corporation
MGC3479, MYLC2PL, PLRLC

Antibody data

Product number
H00093408-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00093408-B01, RRID:AB_1138695
Product name
MYLC2PL MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00093408-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MYLC2PL protein.
Antigen sequence
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRA
EGTASSNVFSMFDQSQIQEFKESLALSPRLERNGM
ISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFID
KEDLRDTFAALGRINVKNEELEAMVKEAPGPINFT
VFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVK
ADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNL
DYRNLCYVITHGEEKD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -