HPA006660

LMNA antibody from Atlas Antibodies
CMD1A, HGPS, LGMD1B, LMN1, LMNL1, MADA, PRO1

Antibody data

Product number
HPA006660
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006660, RRID:AB_1079231
Product name
Anti-LMNA
Provider product page
Atlas Antibodies - HPA006660
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVVSREVSGIKAAYEAELGDARKTLDSVAKERARL
QLELSKVREEFKELKARNTKKEGDLIAAQARLKDL
EALLNSKEAALSTALSEKRTLEGELHDLRGQVAKL
EAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQ
KNIYSEELRE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.