Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Flow cytometry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32392 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- TCP1 gamma Antibody / CCT3
- Antibody type
- Polyclonal
- Antigen
- Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the CCT3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat kidney and 2) human HeLa lysate with CCT3 antibody. Expected/observed molecular weight ~61 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human U-251 MG cells with CCT3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human K562 cells with CCT3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human PC-3 cells with CCT3 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCT3 antibody.
