HPA006543

CCT3 antibody from Sigma-Aldrich
Cctg, TRIC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006543
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006543, RRID:AB_1078426
Product name
Anti-CCT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006543
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLEYKKGESQTDIEITREEDFTRILQMEEEYIQQL
CEDIIQLKPDVVITEKGISDLAQHYLMRANITAIR
RVRKTDNNRIARACGARIVSRPEELREDDVGTGAG
LLEIKKIGDEYFTFITDCKDPK
Storage
-20C
Provider Type Product Number
- No reagents -