Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002266-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002266-M01, RRID:AB_437033
- Product name
- FGG monoclonal antibody (M01), clone 1F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FGG.
- Antigen sequence
RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKD
LQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESS
KPNMIDAATLKSRKMLEEIMKYEASILTHD- Isotype
- IgG
- Antibody clone number
- 1F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of novel diagnostic biomarkers for asthma and chronic obstructive pulmonary disease.
Analysis of proteomic profiles and functional properties of human peripheral blood myeloid dendritic cells, monocyte-derived dendritic cells and the dendritic cell-like KG-1 cells reveals distinct characteristics.
Verrills NM, Irwin JA, He XY, Wood LG, Powell H, Simpson JL, McDonald VM, Sim A, Gibson PG
American journal of respiratory and critical care medicine 2011 Jun 15;183(12):1633-43
American journal of respiratory and critical care medicine 2011 Jun 15;183(12):1633-43
Analysis of proteomic profiles and functional properties of human peripheral blood myeloid dendritic cells, monocyte-derived dendritic cells and the dendritic cell-like KG-1 cells reveals distinct characteristics.
Horlock C, Shakib F, Mahdavi J, Jones NS, Sewell HF, Ghaemmaghami AM
Genome biology 2007;8(3):R30
Genome biology 2007;8(3):R30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FGG monoclonal antibody (M01), clone 1F2 Western Blot analysis of FGG expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FGG is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FGG on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between ICAM1 and FGG. HeLa cells were stained with anti-ICAM1 rabbit purified polyclonal 1:1200 and anti-FGG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)