Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA006667 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006667, RRID:AB_1078979
- Product name
- Anti-GBA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRS
GRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKG
FGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIG
YN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Progressive myoclonus epilepsy in Gaucher Disease due to a new Gly–Gly mutation causing loss of an Exonic Splicing Enhancer
Tonin R, Catarzi S, Caciotti A, Procopio E, Marini C, Guerrini R, Morrone A
Journal of Neurology 2018;266(1):92-101
Journal of Neurology 2018;266(1):92-101
No comments: Submit comment
No validations: Submit validation data