HPA006667

GBA antibody from Sigma-Aldrich
GBA1, GLUC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006667, RRID:AB_1078979
Product name
Anti-GBA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006667
Antibody type
Polyclonal
Antigen
Glucosylceramidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRS
GRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKG
FGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIG
YN
Storage
-20C
Provider Type Product Number
- No reagents -