HPA023021

KLHL11 antibody from Sigma-Aldrich
FLJ10572
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023021, RRID:AB_1852568
Product name
Anti-KLHL11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023021
Antibody type
Polyclonal
Antigen
Kelch-like protein 11 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VANNEVCVKLVADAVERHALRAENIQSGTCQHPTS
HVSLLPRYGQNMDVIMVIGGVSEGGDYLSECVGYF
VDEDRWVNLPHIHNHLDGHAVAVTESYVY
Storage
-20C
Provider Type Product Number
- No reagents -