HPA021320

LRWD1 antibody from Sigma-Aldrich
CENP-33, DKFZp434K1815, ORCA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021320
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021320, RRID:AB_1853372
Product name
Anti-LRWD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021320
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and WD repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVEN
LNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVK
SAVRD
Storage
-20C
Provider Type Product Number
- No reagents -