H00006829-M02A

SUPT5H antibody from Abnova Corporation
FLJ34157, SPT5, SPT5H

Antibody data

Product number
H00006829-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006829-M02A, RRID:AB_1205043
Product name
SUPT5H monoclonal antibody (M02A), clone 5C8
Provider product page
Abnova Corporation - H00006829-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SUPT5H.
Antigen sequence
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVY
LKDSEKVVSISSEHLEPITPTKNNKVKVILGEDRE
ATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLL
EA
Isotype
IgG
Antibody clone number
5C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -