HPA029273

SUPT5H antibody from MilliporeSigma / Merck KGaA
FLJ34157, SPT5, SPT5H
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029273
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029273, RRID:AB_10603896
Product name
Anti-SUPT5H antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029273
Antibody type
Polyclonal
Antigen
suppressor of Ty 5 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTT
DIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLK
DSEKVVSISSEHLEPITPTKNNKVKVILGEDREAT
GVLLSIDGEDGIVRMDLDEQLKILNLRFL
Storage
-20C
Provider Type Product Number
- No reagents -