HPA003724

RNASE11 antibody from Sigma-Aldrich
C14orf6, RAJ1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003724
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003724, RRID:AB_1079817
Product name
Anti-RNASE11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003724
Antibody type
Polyclonal
Antigen
Probable ribonuclease 11 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSLSMSKDDMSSTLLTFRSLHYNDPKGNSSGNDKE
CCNDMTVWRKVSEANGSCKWSNNFIRSSTEVMRRV
HRAPSCKFVQNPGISCCESLELENTVCQFTTGKQF
PRCQYHSVTSLEKILTVLTGHSLMSWL
Storage
-20C
Provider Type Product Number
- No reagents -