Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006277-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006277-M10, RRID:AB_519032
- Product name
- S100A6 monoclonal antibody (M10), clone 6B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant S100A6.
- Antigen sequence
MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELK
ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF
QEYVTFLGALALIYNEALKG- Isotype
- IgG
- Antibody clone number
- 6B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells.
S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.
Chen Y, Huang K, Nakatsu MN, Xue Z, Deng SX, Fan G
Human molecular genetics 2013 Apr 1;22(7):1271-9
Human molecular genetics 2013 Apr 1;22(7):1271-9
S100A expression in normal corneal-limbal epithelial cells and ocular surface squamous cell carcinoma tissue.
Li J, Riau AK, Setiawan M, Mehta JS, Ti SE, Tong L, Tan DT, Beuerman RW
Molecular vision 2011;17:2263-71
Molecular vision 2011;17:2263-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- S100A6 monoclonal antibody (M10), clone 6B5 Western Blot analysis of S100A6 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M10), clone 6B5.Lane 1: S100A6 transfected lysate(10.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to S100A6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to S100A6 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol