Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006277-M16 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006277-M16, RRID:AB_519034
- Product name
- S100A6 monoclonal antibody (M16), clone 6D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant S100A6.
- Antigen sequence
KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAE
IARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEA
LKG- Isotype
- IgG
- Antibody clone number
- 6D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cancer-initiating cells from colorectal cancer patients escape from T cell-mediated immunosurveillance in vitro through membrane-bound IL-4.
Immunobiological characterization of cancer stem cells isolated from glioblastoma patients.
S100A6 overexpression is associated with poor prognosis and is epigenetically up-regulated in gastric cancer.
Volonté A, Di Tomaso T, Spinelli M, Todaro M, Sanvito F, Albarello L, Bissolati M, Ghirardelli L, Orsenigo E, Ferrone S, Doglioni C, Stassi G, Dellabona P, Staudacher C, Parmiani G, Maccalli C
Journal of immunology (Baltimore, Md. : 1950) 2014 Jan 1;192(1):523-32
Journal of immunology (Baltimore, Md. : 1950) 2014 Jan 1;192(1):523-32
Immunobiological characterization of cancer stem cells isolated from glioblastoma patients.
Di Tomaso T, Mazzoleni S, Wang E, Sovena G, Clavenna D, Franzin A, Mortini P, Ferrone S, Doglioni C, Marincola FM, Galli R, Parmiani G, Maccalli C
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Feb 1;16(3):800-13
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 Feb 1;16(3):800-13
S100A6 overexpression is associated with poor prognosis and is epigenetically up-regulated in gastric cancer.
Wang XH, Zhang LH, Zhong XY, Xing XF, Liu YQ, Niu ZJ, Peng Y, Du H, Zhang GG, Hu Y, Liu N, Zhu YB, Ge SH, Zhao W, Lu AP, Li JY, Ji JF
The American journal of pathology 2010 Aug;177(2):586-97
The American journal of pathology 2010 Aug;177(2):586-97
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- S100A6 monoclonal antibody (M16), clone 6D1 Western Blot analysis of S100A6 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M16), clone 6D1.Lane 1: S100A6 transfected lysate(10.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol