HPA007575

S100A6 antibody from Sigma-Aldrich
2A9, CABP, CACY, PRA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007575
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007575, RRID:AB_1079859
Product name
Anti-S100A6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007575
Antibody type
Polyclonal
Antigen
Protein S100-A6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKL
QDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALI
YNE
Storage
-20C
Provider Type Product Number
- No reagents -