Antibody data

Product number
H00079646-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079646-M01, RRID:AB_1136980
Product name
PANK3 monoclonal antibody (M01), clone 3D7
Provider product page
Abnova Corporation - H00079646-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PANK3.
Antigen sequence
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITA
EEEQEEVESLKSIRKYLTSNVAYGSTGIRDVHLEL
KDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFS
TLQTVLCATGGGAYKFEKDFRTIGNLHLHKLDELD
CLVKGLLYIDSVSFNGQAECYYFANASEPERCQKM
PFNLDDPYPLLVVNIGSGVSILAVHSKDNYKRVTG
TSLGGGTFLGLCSLLTGCESFEEALEMASKGDSTQ
ADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEK
RESVSKEDLARATLVTITNNIGSVARMCAVNEKIN
RVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALF
LEHEGYFGAVGALLGLPNFS
Isotype
IgG
Antibody clone number
3D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -