Antibody data

Product number
H00079646-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079646-M05, RRID:AB_1137343
Product name
PANK3 monoclonal antibody (M05), clone 3H4
Provider product page
Abnova Corporation - H00079646-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PANK3.
Antigen sequence
PTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYKFE
KDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQ
AECYYFANASEPERCQKMPFNLD
Isotype
IgG
Antibody clone number
3H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -