Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006658-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006658-M04, RRID:AB_581605
- Product name
- SOX3 monoclonal antibody (M04), clone 1F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SOX3.
- Antigen sequence
KSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGG
DAADAASPLPGGRLHGVHQHYQGAGTAVNGTVPLT
H*- Isotype
- IgG
- Antibody clone number
- 1F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SOX3 monoclonal antibody (M04), clone 1F2 Western Blot analysis of SOX3 expression in A-431 ( Cat # L015V1 ).