ABIN629774

antibody from antibodies-online

Targeting: PRDX6 1-Cys, aiPLA2, AOP2, KIAA0106, MGC46173, NSGPx, p29, PRX

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629774 - Provider product page
Provider: antibodies-online
Product name: anti-Peroxiredoxin 6 (PRDX6) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: PRDX6 antibody was raised using the middle region of PRDX6 corresponding to a region with amino acids ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

PRDX6 protein structure - ABIN629774 shown in red.