H00009588-M01
antibody from Abnova Corporation
Targeting: PRDX6
1-Cys, aiPLA2, AOP2, KIAA0106, MGC46173, NSGPx, p29, PRX
Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009588-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009588-M01, RRID:AB_425812
- Product name
- PRDX6 monoclonal antibody (M01), clone 3A10-2A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PRDX6.
- Antigen sequence
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGI
LFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA
LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDD
RNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD
KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRV
ATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE
LPSGKKYLRYTPQP- Isotype
- IgG
- Antibody clone number
- 3A10-2A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle.
Cellular and molecular large-scale features of fetal adipose tissue: is bovine perirenal adipose tissue brown?.
Functional analysis of beef tenderness.
Peroxiredoxin-6--a potential protein marker for meat tenderness in bovine longissimus thoracis muscle.
Picard B, Gagaoua M, Micol D, Cassar-Malek I, Hocquette JF, Terlouw CE
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Cellular and molecular large-scale features of fetal adipose tissue: is bovine perirenal adipose tissue brown?.
Taga H, Chilliard Y, Meunier B, Chambon C, Picard B, Zingaretti MC, Cinti S, Bonnet M
Journal of cellular physiology 2012 Apr;227(4):1688-700
Journal of cellular physiology 2012 Apr;227(4):1688-700
Functional analysis of beef tenderness.
Guillemin N, Bonnet M, Jurie C, Picard B
Journal of proteomics 2011 Dec 21;75(2):352-65
Journal of proteomics 2011 Dec 21;75(2):352-65
Peroxiredoxin-6--a potential protein marker for meat tenderness in bovine longissimus thoracis muscle.
Jia X, Veiseth-Kent E, Grove H, Kuziora P, Aass L, Hildrum KI, Hollung K
Journal of animal science 2009 Jul;87(7):2391-9
Journal of animal science 2009 Jul;87(7):2391-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRDX6 monoclonal antibody (M01), clone S1. Western Blot analysis of PRDX6 expression in MCF-7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRDX6 monoclonal antibody (M01), clone 3A10-2A11. Western Blot analysis of PRDX6 expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PRDX6 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol