HPA006983

PRDX6 antibody from Atlas Antibodies
1-Cys, aiPLA2, AOP2, KIAA0106, MGC46173, NSGPx, p29, PRX
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006983
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006983, RRID:AB_1079595
Product name
Anti-PRDX6
Provider product page
Atlas Antibodies - HPA006983
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILF
SHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALS
IDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRN
RELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKK
LKLSILYPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -