HPA024371

SUPT3H antibody from Atlas Antibodies
SPT3, SPT3L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024371
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024371, RRID:AB_1857660
Product name
Anti-SUPT3H
Provider product page
Atlas Antibodies - HPA024371
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVD
LALLVRQDMVTKAGDPFSHAISATFIQYHNSAEST
AACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -