HPA024371

SUPT3H antibody from MilliporeSigma / Merck KGaA
SPT3, SPT3L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024371
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024371, RRID:AB_1857660
Product name
Anti-SUPT3H antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024371
Antibody type
Polyclonal
Antigen
Transcription initiation protein SPT3 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVD
LALLVRQDMVTKAGDPFSHAISATFIQYHNSAEST
AACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFT
Storage
-20C
Provider Type Product Number
- No reagents -