H00023641-B01P

LDOC1 antibody from Abnova Corporation
BCUR1, Mar7, Mart7, RTL7, SIRH7

Antibody data

Product number
H00023641-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023641-B01P, RRID:AB_1576781
Product name
LDOC1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00023641-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LDOC1 protein.
Antigen sequence
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVC
ERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ
TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVV
PYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE
EEEDDY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -