Antibody data

Product number
H00007170-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007170-M02, RRID:AB_1137064
Product name
TPM3 monoclonal antibody (M02), clone 2E4
Provider product page
Abnova Corporation - H00007170-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TPM3.
Antigen sequence
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREV
EGERRAREQAEAEVASLNRRIQLVEEELDRAQERL
ATALQKLEEAEKAADESERGMKVIENRALKDEEKM
ELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDL
ERTEERAELAESRCREMDEQIRLMDQNLKRLSAAE
EKYSQKEDKYEGEIKILTDKLKEAETRAEFAERSV
AKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDL
NEM
Isotype
IgG
Antibody clone number
2E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -