HPA009066

TPM3 antibody from Atlas Antibodies
NEM1, TRK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009066
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009066, RRID:AB_1080342
Product name
Anti-TPM3
Provider product page
Atlas Antibodies - HPA009066
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AERLQREVEGERRAREQAEAEVASLNRRIQLVEEE
LDRAQERLATALQKLEEAEKAADESERGMKVIENR
ALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARK
LVIIEGDLERTEERAELAESRCREMDEQIRLMDQN
LKCLSA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -