HPA009066

TPM3 antibody from Sigma-Aldrich
NEM1, TRK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009066
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009066, RRID:AB_1080342
Product name
Anti-TPM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009066
Antibody type
Polyclonal
Antigen
Tropomyosin alpha-3 chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AERLQREVEGERRAREQAEAEVASLNRRIQLVEEE
LDRAQERLATALQKLEEAEKAADESERGMKVIENR
ALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARK
LVIIEGDLERTEERAELAESRCREMDEQIRLMDQN
LKCLSA
Storage
-20C
Provider Type Product Number
- No reagents -