HPA006997

S100A7 antibody from Atlas Antibodies
PSOR1, S100A7c
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006997
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006997, RRID:AB_1079860
Product name
Anti-S100A7
Provider product page
Atlas Antibodies - HPA006997
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKK
DKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -