Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449825 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Adenosine Deaminase, tRNA-Specific 1 (ADAT1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the C terminal of human ADAT1
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEA
ASSYQEAWSTLRKQV- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Identification and characterization of a human tRNA-specific adenosine deaminase related to the ADAR family of pre-mRNA editing enzymes.
Maas S, Gerber AP, Rich A
Proceedings of the National Academy of Sciences of the United States of America 1999 Aug 3;96(16):8895-900
Proceedings of the National Academy of Sciences of the United States of America 1999 Aug 3;96(16):8895-900
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Thymus; WB Suggested Anti-ADAT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Thymus; ADAT1 antibody - C-terminal region (AP43175PU-N) in Human Thymus cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Stomach; Rabbit Anti-ADAT1 Antibody. Paraffin Embedded Tissue: Human Stomach. Cellular Data: Epithelial cells of fundic gland. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; ADAT1 antibody - C-terminal region (AP43175PU-N) in Human Stomach cells using Immunohistochemistry