HPA018670

DHX58 antibody from MilliporeSigma / Merck KGaA
D11LGP2, LGP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018670
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018670, RRID:AB_1847665
Product name
Anti-DHX58 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018670
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DHX58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPC
KQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELS
RKFGTQMYEQQVVKLS
Storage
-20C
Provider Type Product Number
- No reagents -