HPA018670

DHX58 antibody from Atlas Antibodies
D11LGP2, LGP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018670
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018670, RRID:AB_1847665
Product name
Anti-DHX58
Provider product page
Atlas Antibodies - HPA018670
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPC
KQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELS
RKFGTQMYEQQVVKLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -