Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005241-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005241-M08, RRID:AB_518985
- Product name
- PGR monoclonal antibody (M08), clone 4E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
- Antigen sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGP
FPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPE
KDSGL- Isotype
- IgG
- Antibody clone number
- 4E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparison of estrogenic responses in bone and uterus depending on the parity status in Lewis rats.
Keiler AM, Bernhardt R, Scharnweber D, Jarry H, Vollmer G, Zierau O
The Journal of steroid biochemistry and molecular biology 2013 Jan;133:101-9
The Journal of steroid biochemistry and molecular biology 2013 Jan;133:101-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PGR monoclonal antibody (M08), clone 4E9. Western Blot analysis of PGR expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PGR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol