Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005241-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005241-A01, RRID:AB_489669
- Product name
- PGR polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen correspond to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
- Antigen sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGP
FPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPE
KDSGL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data