Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005241-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005241-M07, RRID:AB_518987
- Product name
- PGR monoclonal antibody (M07), clone 5D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
- Antigen sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGP
FPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPE
KDSGL- Isotype
- IgG
- Antibody clone number
- 5D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Major Functional Transcriptome of an Inferred Center Regulator of an ER(-) Breast Cancer Model System.
In Silico Prediction for Regulation of Transcription Factors onTheir Shared Target Genes Indicates Relevant Clinical Implications in a Breast Cancer Population.
Liu LY, Chang LY, Kuo WH, Hwa HL, Lin YS, Huang SF, Chen CN, Chang KJ, Hsieh FJ
Cancer informatics 2012;11:87-111
Cancer informatics 2012;11:87-111
In Silico Prediction for Regulation of Transcription Factors onTheir Shared Target Genes Indicates Relevant Clinical Implications in a Breast Cancer Population.
Liu LY, Chang LY, Kuo WH, Hwa HL, Shyu MK, Chang KJ, Hsieh FJ
Cancer informatics 2012;11:113-37
Cancer informatics 2012;11:113-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PGR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell . [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol