HPA008428

antibody from Atlas Antibodies

Targeting: PGR NR3C3, PR

Antibody data

Submit

Validation data

Product number: HPA008428 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008428, RRID:AB_1079680
Product name: Anti-PGR
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGD FPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEE GAEASARSPRSYLVAGANPAAFPDFPL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PGR protein structure - HPA008428 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human endometrium and testis tissues using Anti-PGR antibody. Corresponding PGR RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA008428 (A) shows similar protein distribution across tissues to independent antibody HPA004751 (B).
Antibody #2 product nr: HPA004751, HPA017176
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows strong nuclear positivity.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA008428.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA008428.
Sample type: HUMAN