Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183147 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chloride Intracellular Channel 5 (CLIC5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the middle region of human CLIC5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLA
AKHRE SNTAGIDIFS- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Chloride intracellular channel 5 modulates adipocyte accumulation in skeletal muscle by inhibiting preadipocyte differentiation.
CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo.
Li FN, Yin JD, Ni JJ, Liu L, Zhang HY, Du M
Journal of cellular biochemistry 2010 Jul 1;110(4):1013-21
Journal of cellular biochemistry 2010 Jul 1;110(4):1013-21
CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo.
Berryman M, Bruno J, Price J, Edwards JC
The Journal of biological chemistry 2004 Aug 13;279(33):34794-801
The Journal of biological chemistry 2004 Aug 13;279(33):34794-801
No comments: Submit comment
No validations: Submit validation data