H00023636-M02
antibody from Abnova Corporation
Targeting: NUP62
DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, p62, SNDI
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023636-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023636-M02, RRID:AB_534967
- Product name
- NUP62 monoclonal antibody (M02), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NUP62.
- Antigen sequence
LQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEH
LNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNS
ALLQRKVEEVTKVCEGRRKEQERSFRITFD- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NUP62 monoclonal antibody (M02), clone 2D3. Western Blot analysis of NUP62 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NUP62 monoclonal antibody (M02), clone 2D3. Western Blot analysis of NUP62 expression in PC-12(Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NUP62 expression in transfected 293T cell line by NUP62 monoclonal antibody (M02), clone 2D3.Lane 1: NUP62 transfected lysate (Predicted MW: 53.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NUP62 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NUP62 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol