HPA004890

SUGP1 antibody from Atlas Antibodies
DKFZp434E2216, F23858, RBP, SF4
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004890
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004890, RRID:AB_888912
Product name
Anti-SUGP1
Provider product page
Atlas Antibodies - HPA004890
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREI
EAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISN
KFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPST
PT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -