HPA004890

SUGP1 antibody from Atlas Antibodies
DKFZp434E2216, F23858, RBP, SF4
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004890
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004890, RRID:AB_1079935
Product name
Anti-SUGP1
Provider product page
Atlas Antibodies - HPA004890
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREI
EAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISN
KFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPST
PT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -