HPA004890

SUGP1 antibody from Sigma-Aldrich
DKFZp434E2216, F23858, RBP, SF4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004890, RRID:AB_1079935
Product name
Anti-SF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004890
Antibody type
Polyclonal
Antigen
Splicing factor 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKANRWFGVAPPKSGKMNMNILHQEELIAQKKREI
EAKMEQKAKQNQVASPQPPHPGEITNAHNSSCISN
KFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPST
PT
Storage
-20C
Provider Type Product Number
- No reagents -