HPA020854

RNF121 antibody from MilliporeSigma / Merck KGaA
FLJ11099
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020854
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020854, RRID:AB_1856326
Product name
Anti-RNF121 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020854
Antibody type
Polyclonal
Antigen
RING finger protein 121 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MRLICQISLQKSNGGSSTHACMPSTVAMKLCMLKW
SSSSSQPWWWPSCSWCSGSRGTHAPTMIKPEDAMD
FGIS
Storage
-20C
Provider Type Product Number
- No reagents -