HPA005445

TULP4 antibody from Sigma-Aldrich
KIAA1397, TUSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005445
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005445, RRID:AB_1080421
Product name
Anti-TULP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005445
Antibody type
Polyclonal
Antigen
Tubby-related protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLLHESDGVLGMSWNYPIFLVEDSSESDTDSDDYA
PPQDGPAAYPIPVQNIKPLLTVSFTSGDISLMNNY
DDLSPTVIRSGLKEVVAQWCTQGDLLAVAGMERQT
QLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQR
PIISICWGH
Storage
-20C
Provider Type Product Number
- No reagents -